PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC3755_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 251aa    MW: 26047 Da    PI: 8.6909
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC3755_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.62.7e-383190362
      zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                +++l+cprCdstntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rk  k+s
  RrC3755_p1 31 QEQLPCPRCDSTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGGTRKAAKRS 90
                7899***************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-28481IPR003851Zinc finger, Dof-type
PfamPF027013.4E-333288IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0033488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0042545Biological Processcell wall modification
GO:0045787Biological Processpositive regulation of cell cycle
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MTTSDSGESR RTAMTRPHGG LTGLPPATVQ QEQLPCPRCD STNTKFCYYN NYNFSQPRHF  60
CKSCRRYWTH GGTLRDIPVG GGTRKAAKRS RTCSSSSSAG ALDVPLQATP VLFPQTSLSN  120
GVGHAVTVTA PLENGGKGSS LSLCGSFTSL LSQNANAAPA THGPGGFGSG LGSGFGDVSF  180
GLGRAAWPFP TVMGDAAAAT NVASNGGHHA VQMPATWQFE GLESNNAGGF VPGEYFAWPD  240
LSITTPVSSL K
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00402DAPTransfer from AT3G50410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009136544.11e-143PREDICTED: dof zinc finger protein DOF3.4-like
SwissprotQ390881e-110DOF34_ARATH; Dof zinc finger protein DOF3.4
TrEMBLA0A078G9B61e-144A0A078G9B6_BRANA; BnaC07g31770D protein
STRINGBra012901.1-P1e-143(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22862874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.11e-86OBF binding protein 1